PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo1G0067400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 251aa    MW: 28803.7 Da    PI: 8.2727
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo1G0067400genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.1e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+  ++ +G g+W++ ++  g+ R++k+c++rw +yl
   Spipo1G0067400 14 KGAWTKEEDDRLIAHIRAHGEGNWRSLPKAAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding57.92.4e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T eEdel+++++ +lG++ W+ Ia +++ gRt++++k++w+++
   Spipo1G0067400  67 RGNFTDEEDELIIKLHSLLGNK-WSMIAGRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.4E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.429961IPR017930Myb domain
SuperFamilySSF466895.29E-3013108IPR009057Homeodomain-like
SMARTSM007172.3E-131363IPR001005SANT/Myb domain
PfamPF002498.7E-151461IPR001005SANT/Myb domain
CDDcd001677.40E-101661No hitNo description
PROSITE profilePS5129428.79762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.8E-2865116IPR009057Homeodomain-like
SMARTSM007176.8E-1766114IPR001005SANT/Myb domain
PfamPF002499.2E-1667111IPR001005SANT/Myb domain
CDDcd001671.12E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010224Biological Processresponse to UV-B
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:1903086Biological Processnegative regulation of sinapate ester biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDDRLIAHIR AHGEGNWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TDEEDELIIK LHSLLGNKWS MIAGRLPGRT DNEIKNYWNT HIRRKLLNRG  120
IDPSTHRPLH EPVSDVALSV TKEEEKVVAH RLRREEEKSS SEELSLSSSQ TQPQQQEQRC  180
PDLNLDLCIS LPYDEEVQQR HTRESSLEAF KGETGACFNC RLGLQKSKGC MCNSFLGLSM  240
GFLDYRSLEM K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-301311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00479DAPTransfer from AT4G38620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010920127.11e-121PREDICTED: myb-related protein 308-like
SwissprotP200261e-105MYB1_HORVU; Myb-related protein Hv1
TrEMBLA0A140GNA81e-120A0A140GNA8_ELAGV; R2R3 MYB transcription factor
STRINGOB09G24400.11e-116(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.13e-97myb domain protein 4